PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00291.1_g00015.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 265aa    MW: 30794 Da    PI: 7.7097
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00291.1_g00015.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.92.3e-54101351128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeel+v+yL++++ +k++++ ++i+evdiyk++Pw+Lp+k++ +e+ewyfFs+r++ky++g r+nra+ sgyWkat
  Rsa1.0_00291.1_g00015.1  10 LPPGFRFHPTDEELIVYYLRNQTMSKPCPV-SIIPEVDIYKFDPWQLPEKTEFGENEWYFFSPRERKYPNGVRPNRAAVSGYWKAT 94 
                              79****************************.89***************99999********************************* PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g+dk+++s ++++vg+kk Lvfykgr pkg ktdW+mheyrl
  Rsa1.0_00291.1_g00015.1  95 GTDKAIHS-GSRNVGVKKALVFYKGRPPKGIKTDWIMHEYRL 135
                              ********.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.15E-666162IPR003441NAC domain
PROSITE profilePS5100560.82710162IPR003441NAC domain
PfamPF023659.7E-2711135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009825Biological Processmultidimensional cell growth
GO:0009835Biological Processfruit ripening
GO:0009908Biological Processflower development
GO:0010150Biological Processleaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
METNSNSTTL PPGFRFHPTD EELIVYYLRN QTMSKPCPVS IIPEVDIYKF DPWQLPEKTE  60
FGENEWYFFS PRERKYPNGV RPNRAAVSGY WKATGTDKAI HSGSRNVGVK KALVFYKGRP  120
PKGIKTDWIM HEYRLHDSRK ASTKRNGSMR LDEWVLCRIY KKKGAGKLLD EKEGFMDEVQ  180
IDETLAGRRN EEEIMMMTST KLPRTCSLAH LLEMDYMGPI SHILTPFDLH HPDLNGMNES  240
GWFGDLQVNQ DEISNHHRQA SMFQF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-70916716170NO APICAL MERISTEM PROTEIN
1ut4_B1e-70916716170NO APICAL MERISTEM PROTEIN
1ut7_A1e-70916716170NO APICAL MERISTEM PROTEIN
1ut7_B1e-70916716170NO APICAL MERISTEM PROTEIN
3swm_A1e-70916719173NAC domain-containing protein 19
3swm_B1e-70916719173NAC domain-containing protein 19
3swm_C1e-70916719173NAC domain-containing protein 19
3swm_D1e-70916719173NAC domain-containing protein 19
3swp_A1e-70916719173NAC domain-containing protein 19
3swp_B1e-70916719173NAC domain-containing protein 19
3swp_C1e-70916719173NAC domain-containing protein 19
3swp_D1e-70916719173NAC domain-containing protein 19
4dul_A1e-70916716170NAC domain-containing protein 19
4dul_B1e-70916716170NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00221DAPTransfer from AT1G69490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3535240.0AK353524.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-48-K20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013649091.10.0PREDICTED: NAC transcription factor 29-like isoform X1
SwissprotO492551e-169NAC29_ARATH; NAC transcription factor 29
TrEMBLA0A078F6Q20.0A0A078F6Q2_BRANA; BnaA07g24270D protein
STRINGBra004385.1-P1e-180(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM77072641
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.11e-170NAC-like, activated by AP3/PI